| Cat.No.: | PE-2413 |
| Background: | Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. Can suppress brain tumor angiogenesis through transcriptional repression of RELA/NFKB3 target genes when complexed with RELA. May also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. Represses hypoxia inducible factor's (HIF) activity by interacting with HIF prolyl hydroxylase 2 (EGLN1). |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 55 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl |
| Accession#: | Q9UNL4 |
| Alternative Names: | Brain my036 protein/Candidate tumor suppressor p33 ING 1 homolog/Candidate tumor suppressor p33 ING1 homolog |
| Amino Acid Sequence: | MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM SSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRL DTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNS DEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCL CHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK |
| Sequence Similarities: | Belongs to the ING family.Contains 1 PHD-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 249 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.