Recombinant Human ING4 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2413
Background:  Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. Can suppress brain tumor angiogenesis through transcriptional repression of RELA/NFKB3 target genes when complexed with RELA. May also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. Represses hypoxia inducible factor's (HIF) activity by interacting with HIF prolyl hydroxylase 2 (EGLN1).
Applications:  ELISA; Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  55 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl
Accession#:  Q9UNL4
Alternative Names:  Brain my036 protein/Candidate tumor suppressor p33 ING 1 homolog/Candidate tumor suppressor p33 ING1 homolog
Amino Acid Sequence:  MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM SSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRL DTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNS DEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCL CHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Sequence Similarities:  Belongs to the ING family.Contains 1 PHD-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 249
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.