Cat.No.: | PE-2409 |
Product Name: | Recombinant Human KAT2A / GCN5 protein |
Background: | Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. |
Applications: | SDS-PAGE; Mass Spectrometry |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 51 kDa including tags |
Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl |
Accession#: | Q92830 |
Alternative Names: | 1110051E14Rik/AW212720/EC 2.3.1.48 |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENL TLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETA RLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGY GTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG YIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVY PGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNL LAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTR KLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
Sequence Similarities: | Belongs to the GCN5 family.Contains 1 bromo domain.Contains 1 N-acetyltransferase domain. |
Expression System: | E. coli |
Protein Length: | Full length protein; 411 to 837 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0037 | CPTH2 | Inquiry |
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
Related Gene / Proteins | |||
GCN5 | Kaiso | KANSL2 | KAP1 |
KAT13A | KAT13D | KAT2A | KAT2B |
KAT4 | KAT5 | KAT6A | KAT6B |
KAT7 | KAT8 | KAT9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools