Recombinant Human KDM5A / Jarid1A / RBBP2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2406
Background:  Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.
Applications:  SDS-PAGE; Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl. Note: Glutathione is reduced
Accession#:  P29375
Alternative Names:  Histone demethylase JARID1A/JARID1A/Jumonji/ARID domain containing protein 1A
Tag:  GST
Amino Acid Sequence:  KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Sequence Similarities:  Belongs to the JARID1 histone demethylase family.Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 3 PHD-type zinc fingers.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 191 to 290
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart