| Cat.No.: | PE-2395 |
| Background: | CDY2A, an intronless gene, encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. proteins are components of heterochromatin like complexes and can act as gene repressors. It may have histone acetyltransferase activity. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CDY/CDY2/CDY2B |
| Tag: | GST |
| Amino Acid Sequence: | ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQD TVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 123 to 214 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0112 | Human CDKN1B Knockout Cell Line 10bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0118 | Recombinant Mouse CDK1 Cell Lysate | Inquiry |
| EL-0119 | Recombinant Human CDK1 Cell Lysate | Inquiry |
| EL-0209 | Recombinant Human CD1D & B2M Cell Lysate | Inquiry |
| EL-0210 | Recombinant Human CD1D Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CD1D | CDA | CDC34 | CDK1 |
| CDK8 | CDK9 | CDKA1 | CDKN1B |
| CDX1 | CDY2A | CDYL | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools