Recombinant Human CDY2A protein


  • Specification
  • Related Products
Cat.No.:  PE-2395
Product Name:  Recombinant Human CDY2A protein
Background:  CDY2A, an intronless gene, encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. proteins are components of heterochromatin like complexes and can act as gene repressors. It may have histone acetyltransferase activity.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  CDY/CDY2/CDY2B
Tag:  GST
Amino Acid Sequence:  ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQD TVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS
Expression System:  Wheat germ
Protein Length:  Protein fragment; 123 to 214
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.