| Cat.No.: | PE-2393 |
| Background: | CECR1 (Cat eye syndrome chromosome region candidate 1) is a member of the adenosine and AMP deaminases family. It may act as a growth factor and have adenosine deaminase activity. It is a candidate gene for cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | ADGF/Cat eye syndrome chromosome region candidate 1/Cat eye syndrome critical region protein 1 |
| Tag: | GST |
| Amino Acid Sequence: | DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGL SYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRW DKFIADVATK |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 402 to 511 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0054 | Human CECR2 Knockout Cell Line 13bp deletion | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0191 | Human CENPA peptide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0219 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| EL-0220 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0340 | NVS-CECR2-1 | Inquiry |
| Related Gene / Proteins | |||
| CEACAM1 | CECR1 | CECR2 | CELF-5 |
| CELF-6 | CENH3 | CENPA | CENPB |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.