| Cat.No.: | PE-2386 |
| Background: | Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | C11orf19/dJ68P15A.1/Elongation protein 4 homolog |
| Tag: | GST |
| Amino Acid Sequence: | YFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHK TPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASN |
| Sequence Similarities: | Belongs to the ELP4 family. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 101 to 199 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0191 | Recombinant Human ELP3 Cell Lysate | Inquiry |
| EL-0199 | Recombinant Human ELP2 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0314 | ELAVL3 Polyclonal Antibody | Inquiry |
| EAb-1079 | ELP3 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-1082 | ELP3 Polyclonal Antibody, FITC Conjugated | Inquiry |
| Related Gene / Proteins | |||
| ELAVL3 | ELE1 | Elk-1 | ELP2 |
| ELP3 | ELP4 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.