Recombinant Human Elp4 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2386
Background:  Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  C11orf19/dJ68P15A.1/Elongation protein 4 homolog
Tag:  GST
Amino Acid Sequence:  YFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHK TPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASN
Sequence Similarities:  Belongs to the ELP4 family.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 101 to 199
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.