Cat.No.: | PE-2383 |
Product Name: | Recombinant Human FBXO16 protein |
Background: | FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. FBXO16 probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. It is expressed in heart, spleen and colon. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | FBXO16/F box only protein 16/F box protein 16 |
Tag: | GST |
Amino Acid Sequence: | MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWT DSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 1 to 100 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Research Kits | ||
EKIT-0183 | FBXL10 (KDM2B) Chemiluminescent Assay Kit | Inquiry |
EKIT-0184 | FBXL11 (KDM2A) Homogeneous Assay Kit | Inquiry |
EKIT-0558 | FBXL10 (KDM2B) Homogeneous Assay Kit | Inquiry |
◆ Cell Lines | ||
CL-0199 | Human FBXO38 Knockout Cell Line | Inquiry |
◆ Antibodies | ||
EAb-0304 | FBL Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
FBL | FBXL10 | FBXL11 | FBXL17 |
FBXL18 | FBXL2 | FBXO15 | FBXO16 |
FBXO24 | FBXO25 | FBXO28 | FBXO3 |
FBXO30 | FBXO38 | FBXO40 | FBXO44 |
FBXW10 | FBXW12 | FBXW2 | FBXW9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools