Recombinant Human FBXW9 protein


  • Specification
  • Related Products
Cat.No.:  PE-2381
Background:  Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  F box and WD 40 domain containing protein 9/F box/WD repeat containing protein 9/F-box and WD-40 domain-containing protein 9
Tag:  GST
Amino Acid Sequence:  MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTR ACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTC PQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
Sequence Similarities:  Contains 1 F-box domain.Contains 7 WD repeats.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 135
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart