Recombinant Human GPS2 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2378
Background:  GPS2(G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signalling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  AMF 1/AMF1/G protein pathway suppressor 2
Tag:  GST
Amino Acid Sequence:  QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQ ALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Expression System:  Wheat germ
Protein Length:  Protein fragment; 228 to 327
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.