| Cat.No.: | PE-2378 |
| Background: | GPS2(G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signalling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | AMF 1/AMF1/G protein pathway suppressor 2 |
| Tag: | GST |
| Amino Acid Sequence: | QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQ ALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 228 to 327 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0183 | Human GPRASP1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2378 | Recombinant Human GPS2 protein | Inquiry |
| PE-2514 | Recombinant Human GPATCH3 protein | Inquiry |
| PE-2515 | Recombinant Human GPATCH2 protein | Inquiry |
| PE-2958 | Recombinant Human XAB1/GPN1 protein | Inquiry |
| Related Gene / Proteins | |||
| GPATCH2 | GPATCH3 | GPN1 | GPRASP1 |
| GPS2 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
