| Cat.No.: | PE-2377 |
| Background: | Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. |
| Applications: | SDS-PAGE; Functional Studies |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 65 kDa including tags |
| Purity: | >37 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione |
| Accession#: | B2RXH2 |
| Alternative Names: | JMJD2E/KDM4D-like protein/KDM4DL |
| Tag: | GST |
| Amino Acid Sequence: | KSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPP KEWKARQMYDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRL ANSKKYQTPPHQNFADLEQRYWKSHPGNPPIYGADISGSLFEESTKQWNL GHLGTILDLLEQECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYL HFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLRHKVALISPTVL KENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYG KMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQ |
| Expression System: | Sf9 Insect Cells |
| Protein Length: | Protein fragment; 2 to 337 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.