| Cat.No.: | PE-2371 |
| Product Name: | Recombinant human KMT5A / SETD8 / Pr-SET7 protein |
| Background: | Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNA during mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substrate compared to free histones. Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes. |
| Applications: | SDS-PAGE; Functional Studies |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 44 kDa including tags |
| Purity: | >84 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.0; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione |
| Accession#: | Q9NQR1-2 |
| Alternative Names: | H4 K20 HMTase/H4 K20 specific histone methyltransferase/H4-K20-HMTase SETD8 |
| Tag: | GST |
| Amino Acid Sequence: | KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family. PR/SET subfamily.Contains 1 SET domain. |
| Expression System: | E. coli |
| Protein Length: | Protein fragment; 195 to 352 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 More > |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 |
| SETMAR | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools