Recombinant human KMT5A / SETD8 / Pr-SET7 protein


  • Specification
  • Related Products
Cat.No.:  PE-2371
Background:  Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNA during mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substrate compared to free histones. Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes.
Applications:  SDS-PAGE; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  44 kDa including tags
Purity:  >84 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.0; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione
Accession#:  Q9NQR1-2
Alternative Names:  H4 K20 HMTase/H4 K20 specific histone methyltransferase/H4-K20-HMTase SETD8
Tag:  GST
Amino Acid Sequence:  KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH
Sequence Similarities:  Belongs to the histone-lysine methyltransferase family. PR/SET subfamily.Contains 1 SET domain.
Expression System:  E. coli
Protein Length:  Protein fragment; 195 to 352
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart