Recombinant Human APOBEC2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2365
Product Name:  Recombinant Human APOBEC2 protein
Background:  APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  APOBEC1-LIKE/Apolipoprotein B mRNA editing enzyme catalytic polypeptide 2/Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 2
Tag:  GST
Amino Acid Sequence:  MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPAN FFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAE EAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLIL VGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESK AFQPWEDIQENFLYYEEKLADILK
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 224
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.