Recombinant Human APOBEC3C/PBI protein


  • Specification
  • Related Products
Cat.No.:  PE-2363
Product Name:  Recombinant Human APOBEC3C/PBI protein
Background:  Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  A3C/ABC3C_HUMAN/APOBEC1 like
Tag:  GST
Amino Acid Sequence:  MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSW KTGVFRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDC AGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDY EDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ
Sequence Similarities:  Belongs to the cytidine and deoxycytidylate deaminase family.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 190
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.