Cat.No.: | PE-2359 |
Product Name: | Recombinant Human BRD8/p120 protein |
Background: | BRD8 / p120 may act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. It interacts with MYC and adenovirus E1A protein. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | BRD8/Bromodomain containing 8/p120 |
Tag: | GST |
Amino Acid Sequence: | RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKR GEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 33 to 128 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Synthetic Peptides | ||
SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
SP-0004 | Bromodomain Ligand 3 | Inquiry |
SP-0006 | Bromodomain Ligand 4 | Inquiry |
Related Gene / Proteins | |||
BRCA1 | BRCA2 | BRCC3 | BRD |
brd1 | brd2 | brd3 | brd4 |
BRD7 | BRD8 | brd9 | brdt |
BRL | BRM | BRMS1 | BRPF1 |
BRPF2 | brpf3 | BRWD1 | BRWD3 More > |
p100 | p105 | p120 | p150 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools