| Cat.No.: | PE-2343 |
| Background: | Controls PGR and ESR1 protein levels through their targeting for ubiquitination and subsequent proteasomal degradation. |
| Applications: | Western blot; ELISA; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 51 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q9H467 |
| Alternative Names: | bA18I14.5/C10orf66/Chromosome 10 open reading frame 66 |
| Amino Acid Sequence: | MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEE NFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQS SGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVD VLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDL PRRLRGPQKDELKSFILQKYMMVDSA |
| Sequence Similarities: | Belongs to the CUEDC2 family.Contains 1 CUE domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 226 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0383 | CUEDC2 Polyclonal Antibody | Inquiry |
| EAb-1418 | CUEDC2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-1419 | CUEDC2 Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-1420 | CUEDC2 Polyclonal Antibody, Biotin Conjugated | Inquiry |
| EAb-1422 | CUEDC2 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CUEDC2 | CUG-BP1 | CUL4B | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools