Recombinant Human PARG protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2332
Background:  Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells.
Applications:  ELISA; SDS-PAGE; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  38 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q86W56
Alternative Names:  ADP riboseglycohydrolase/Mitochondrial poly(ADP ribose) glycohydrolase/Parg
Amino Acid Sequence:  YSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKK DSKITDHLMRLPKAEDRRKEQWETKHQRTERKIPKYVPPHLSPDKKWLGT PIEEMRRMPRC
Sequence Similarities:  Belongs to the poly(ADP-ribose) glycohydrolase family.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 357 to 467
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.