Cat.No.: | PE-2331 |
Product Name: | Recombinant Human MTR protein |
Background: | MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. |
Applications: | ELISA; SDS-PAGE; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 38 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Accession#: | Q99707 |
Alternative Names: | 5-methyltetrahydrofolate homocysteine methyltransferase/5-methyltetrahydrofolate-homocysteine methyltransferase/cblG |
Amino Acid Sequence: | RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHE RVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLA DIEQSTGIRL |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 1094 to 1203 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
◆ Extracts & Lysates | ||
EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0325 | MTF2 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-0435 | Recombinant Human MTA2, GST-tagged | Inquiry |
Related Gene / Proteins | |||
MTA | MTA1 | MTA2 | MTA3 |
MTF1 | MTF2 | MTR |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools