| Cat.No.: | PE-2331 |
| Background: | MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 38 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q99707 |
| Alternative Names: | 5-methyltetrahydrofolate homocysteine methyltransferase/5-methyltetrahydrofolate-homocysteine methyltransferase/cblG |
| Amino Acid Sequence: | RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHE RVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLA DIEQSTGIRL |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1094 to 1203 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
| EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0325 | MTF2 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0435 | Recombinant Human MTA2, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| MTA | MTA1 | MTA2 | MTA3 |
| MTF1 | MTF2 | MTR | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.