Cat.No.: | PE-2327 |
Product Name: | Recombinant Human Myt1/MTF1 protein |
Background: | Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. |
Applications: | ELISA; SDS-PAGE; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 37 kDa including tags |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Accession#: | Q01538 |
Alternative Names: | C20orf36/KIAA0835/KIAA1050 |
Amino Acid Sequence: | DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILN LSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS |
Sequence Similarities: | Contains 7 C2HC-type zinc fingers. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 586 to 685 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
◆ Extracts & Lysates | ||
EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
◆ Antibodies | ||
EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
MTA | MTA1 | MTA2 | MTA3 |
MTF1 | MTF2 | MTR | MYB |
Myc | MYCBP | Myf-5 | Myocilin |
MyoD | MYSM1 | MYST1 | MYST3 |
Myt1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools