Recombinant Human SIRT3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2326
Background:  NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  34 kDa including tags
Purity:  > 95 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride
Accession#:  Q9NTG7
Alternative Names:  hSIRT 3/hSIRT3/Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGA GISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERV SGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGV VKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRS SVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDL VQRETGKLDGPDK
Sequence Similarities:  Belongs to the sirtuin family. Class I subfamily.Contains 1 deacetylase sirtuin-type domain.
Expression System:  E. coli
Post Translational Modifications:  Processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Such processing is probably essential for its enzymatic activity.
Protein Length:  Protein fragment; 118 to 399
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart