Cat.No.: | PE-2323 |
Product Name: | Recombinant human KAT3A / CBP protein |
Background: | Acetylates histones, giving a specific tag for transcriptional activation. Also acetylates non-histone proteins, like NCOA3 coactivator. Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1 in the presence of EP300. |
Applications: | SDS-PAGE; Functional Studies |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 41 kDa including tags |
Purity: | >96 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 8; Constituents: 0.04% Tween, 20% Glycerol, 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride |
Accession#: | Q92793 |
Alternative Names: | CBP/CBP_HUMAN/CREB binding protein |
Tag: | GST |
Amino Acid Sequence: | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSRKKIFKPEELRQALMPTLE ALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE PWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
Sequence Similarities: | Contains 1 bromo domain.Contains 1 KIX domain.Contains 2 TAZ-type zinc fingers.Contains 1 ZZ-type zinc finger. |
Expression System: | E. coli |
Post Translational Modifications: | Methylation of the KIX domain by CARM1 blocks association with CREB. This results in the blockade of CREB signaling, and in activation of apoptotic response.Phosphorylated upon DNA damage, probably by ATM or ATR.Sumoylation negatively regulates transcriptional activity via the recruitment of DAAX. |
Protein Length: | Protein fragment; 1081 to 1197 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0055 | Human CREBBP Knockout Cell Line 1bp insertion | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0094 | C646 | Inquiry |
BSM-0124 | EML-425 | Inquiry |
BSM-0150 | I-CBP112 (Hydrochloride) | Inquiry |
◆ Research Kits | ||
EKIT-0122 | CBP bromodomain TR-FRET Assay Kit | Inquiry |
Related Gene / Proteins | |||
CREB | CREB3 | crebbp | CRISP1 |
CRISP3 | CRP |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools