| Cat.No.: | PE-2316 |
| Background: | Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | HAT 3/Histone acetyltransferase MYST3/Monocytic leukemia zinc finger protein |
| Tag: | GST |
| Amino Acid Sequence: | ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKD VSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK |
| Sequence Similarities: | Belongs to the MYST (SAS/MOZ) family.Contains 1 C2HC-type zinc finger.Contains 1 H15 (linker histone H1/H5 globular) domain.Contains 2 PHD-type zinc fingers. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Autoacetylated.Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Protein fragment; 81 to 179 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0174 | MOZ-IN-3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
| EAb-0204 | c-Myb Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0221 | Recombinant Human MORF4L2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MOF | MORC2 | MORC3 | MORF |
| MORF4L2 | MOZ | MYB | Myc |
| MYCBP | Myf-5 | Myocilin | MyoD |
| MYSM1 | MYST1 | MYST3 | Myt1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools