Cat.No.: | PE-2306 |
Product Name: | Recombinant Human KAT6B / MORF protein |
Background: | Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Accession#: | Q8WYB5 |
Alternative Names: | DKFZp313G1618/FLJ90335/Histone acetyltransferase MORF |
Tag: | GST |
Amino Acid Sequence: | FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNI EKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY |
Sequence Similarities: | Belongs to the MYST (SAS/MOZ) family.Contains 1 C2HC-type zinc finger.Contains 1 H15 (linker histone H1/H5 globular) domain.Contains 2 PHD-type zinc fingers. |
Expression System: | Wheat germ |
Post Translational Modifications: | Autoacetylated. |
Protein Length: | Protein fragment; 80 to 172 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 | MOF | MORC2 |
MORC3 | MORF | MORF4L2 | MOZ |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools