Recombinant Human KAT6B / MORF protein


  • Specification
  • Related Products
Cat.No.:  PE-2306
Product Name:  Recombinant Human KAT6B / MORF protein
Background:  Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q8WYB5
Alternative Names:  DKFZp313G1618/FLJ90335/Histone acetyltransferase MORF
Tag:  GST
Amino Acid Sequence:  FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNI EKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY
Sequence Similarities:  Belongs to the MYST (SAS/MOZ) family.Contains 1 C2HC-type zinc finger.Contains 1 H15 (linker histone H1/H5 globular) domain.Contains 2 PHD-type zinc fingers.
Expression System:  Wheat germ
Post Translational Modifications:  Autoacetylated.
Protein Length:  Protein fragment; 80 to 172
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.