Recombinant Human KMT3B / NSD1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2297
Product Name:  Recombinant Human KMT3B / NSD1 protein
Background:  Histone methyltransferase. Preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro). Transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending on the cellular context.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q96L73
Alternative Names:  Androgen receptor coactivator 267 kDa protein/Androgen receptor-associated protein of 267 kDa/ARA267
Tag:  GST
Amino Acid Sequence:  DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLS TVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPE KSDSRAQT
Sequence Similarities:  Belongs to the histone-lysine methyltransferase family.Contains 1 AWS domain.Contains 4 PHD-type zinc fingers.Contains 1 post-SET domain.Contains 2 PWWP domains.Contains 1 SET domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 2 to 109
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.