| Cat.No.: | PE-2297 |
| Background: | Histone methyltransferase. Preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro). Transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending on the cellular context. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q96L73 |
| Alternative Names: | Androgen receptor coactivator 267 kDa protein/Androgen receptor-associated protein of 267 kDa/ARA267 |
| Tag: | GST |
| Amino Acid Sequence: | DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLS TVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPE KSDSRAQT |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family.Contains 1 AWS domain.Contains 4 PHD-type zinc fingers.Contains 1 post-SET domain.Contains 2 PWWP domains.Contains 1 SET domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 2 to 109 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0113 | Human NSD1 Knockout Cell Line 4bp deletion | Inquiry |
| CL-0216 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| CL-0475 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0172 | Human KMT2C / MLL3 peptide | Inquiry |
| ◆ Research Kits | ||
| EKIT-0287 | NSD1 Chemiluminescent Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| nsd1 | NSD2 | NSD3 | NSMCE2 |
| NSUN1 | NSUN2 | NSUN3 | NSUN4 More > |
| NSUN5 | NSUN6 | NSUN7 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools