| Cat.No.: | PE-2293 |
| Background: | Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Male specific lethal 2 homolog/Male specific lethal 2 homolog (Drosophila)/Male specific lethal 2 homolog 1 |
| Tag: | GST |
| Amino Acid Sequence: | GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTL GINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF |
| Sequence Similarities: | Belongs to the MSL2 family.Contains 1 RING-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 478 to 575 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0104 | Recombinant Human MSL1 Lysate | Inquiry |
| EL-0193 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0194 | Recombinant Human MSL3 293 Cell Lysate | Inquiry |
| EL-0218 | Recombinant Human MSH6 293 Cell Lysate | Inquiry |
| EL-0227 | Recombinant Human MSL2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MS4A7 | MSH2 | MSH3 | MSH5 |
| MSH6 | MSI2 | MSL1 | MSL2 |
| MSL3 | MSP58 | MST1 | MSY2 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools