Cat.No.: | PE-2291 |
Product Name: | Recombinant Human MTA2/PID protein |
Background: | May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | DKFZp686F2281/Mata1l1/Metastasis associated 1 family member 2 |
Tag: | GST |
Amino Acid Sequence: | VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGV PFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL |
Sequence Similarities: | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 521 to 620 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0053 | PIM1 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
BSM-0200 | Quercetin, Dihydrate | Inquiry |
◆ Extracts & Lysates | ||
EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
MTA | MTA1 | MTA2 | MTA3 |
MTF1 | MTF2 | MTR | PI3K |
PIAS2 | PIAS4 | PIASy | PID |
PIM | PIM1 | PIM1 | PIM2 |
PITX2 | PiwiL2 | PIWIL4 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools