| Cat.No.: | PE-2291 |
| Background: | May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | DKFZp686F2281/Mata1l1/Metastasis associated 1 family member 2 |
| Tag: | GST |
| Amino Acid Sequence: | VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGV PFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL |
| Sequence Similarities: | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 521 to 620 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0053 | PIM1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
| BSM-0200 | Quercetin, Dihydrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
| EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| MTA | MTA1 | MTA2 | MTA3 |
| MTF1 | MTF2 | MTR | PI3K |
| PIAS2 | PIAS4 | PIASy | PID |
| PIM | PIM1 | PIM1 | PIM2 |
| PITX2 | PiwiL2 | PIWIL4 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
