Recombinant Human Peregrin/BRPF1 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2278
Background:  Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  BR140/Bromodomain and PHD finger containing 1/Bromodomain and PHD finger-containing protein 1
Tag:  GST
Amino Acid Sequence:  ILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQ SRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKS
Sequence Similarities:  Contains 1 bromo domain.Contains 1 C2H2-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Expression System:  Wheat germ
Post Translational Modifications:  Acetylated by KAT6A.
Protein Length:  Protein fragment; 500 to 590
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.