Recombinant human PRMT8 protein


  • Specification
  • Related Products
Cat.No.:  PE-2272
Product Name:  Recombinant human PRMT8 protein
Background:  Membrane-associated arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA). Able to mono- and dimethylate EWS protein; however its precise role toward EWS remains unclear as it still interacts with fully methylated EWS.
Applications:  SDS-PAGE; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  41 kDa including tags
Purity:  >92 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol80 µg/mL FLAG peptide
Accession#:  Q9NR22
Alternative Names:  ANM8_HUMAN/Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4/Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4
Tag:  His-DDDDK
Amino Acid Sequence:  MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVF KDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDN IITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLV DIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTY FNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Sequence Similarities:  Belongs to the protein arginine N-methyltransferase family. PRMT8 subfamily.
Expression System:  Sf9 Insect Cells
Protein Length:  Protein fragment; 61 to 394
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.