Cat.No.: | PE-2270 |
Product Name: | Recombinant Human RNF217 protein |
Background: | RNF217 is an E3 ubiquitin protein ligase which accepts ubiquitin from E2 ubiquitin conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | C6orf172/dJ84N20.1/IBR domain containing 1 |
Tag: | GST |
Amino Acid Sequence: | KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSST KPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 2 to 100 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0123 | Human RNF167 Knockout Cell Line | Inquiry |
CL-0124 | Human RNF2 Knockout Cell Line 553bp insertion | Inquiry |
CL-0125 | Human RNF25 Knockout Cell Line | Inquiry |
CL-0126 | Human RNF26 Knockout Cell Line | Inquiry |
CL-0127 | Human RNF24 Knockout Cell Line | Inquiry |
Related Gene / Proteins | |||
RNA Helicase A | RNA pol II | RNF103 | RNF11 |
RNF128 | RNF133 | RNF138 | RNF141 |
RNF167 | RNF168 | RNF181 | RNF182 |
RNF183 | RNF2 | RNF20 | RNF207 |
RNF208 | RNF212 | RNF213 | RNF214 More > |
RNF215 | RNF217 | RNF219 | RNF220 |
RNF222 | RNF223 | RNF224 | RNF24 |
RNF25 | RNF26 | RNF31 | RNF40 |
RNF7 | RNF8 | RNP | RNPC3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools