Recombinant Human RNF217 protein


  • Specification
  • Related Products
Cat.No.:  PE-2270
Product Name:  Recombinant Human RNF217 protein
Background:  RNF217 is an E3 ubiquitin protein ligase which accepts ubiquitin from E2 ubiquitin conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  C6orf172/dJ84N20.1/IBR domain containing 1
Tag:  GST
Amino Acid Sequence:  KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSST KPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
Expression System:  Wheat germ
Protein Length:  Protein fragment; 2 to 100
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.