Cat.No.: | PE-2268 |
Product Name: | Recombinant Human SAP30 protein |
Background: | Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 30 kDa Sin3-associated polypeptide/Histone deacetylase complex subunit SAP 30/Histone deacetylase complex subunit SAP30 |
Tag: | GST |
Amino Acid Sequence: | MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAV SAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKI ELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDL YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF IYSVKNDKNKSDLKVDSGVH |
Sequence Similarities: | Belongs to the SAP30 family. |
Expression System: | Wheat germ |
Protein Length: | Full length protein; 1 to 220 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0034 | SALL1 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0058 | 3-Deazaadenosine | Inquiry |
◆ Extracts & Lysates | ||
EL-0152 | Recombinant Human SAP30L 293 Cell Lysate | Inquiry |
EL-0155 | Recombinant Human SAP30BP 293 Cell Lysate | Inquiry |
EL-0164 | Recombinant Human SAP30 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
SAH | SALL1 | SALL4 | SAP130 |
SAP145 | SAP18 | SAP30 | SAP30BP |
SAP30L | SART3 | SATB1 | SATB2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools