| Cat.No.: | PE-2266 |
| Background: | Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC) to the nucleolus. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | FLJ11526/FLJ23595/FLJ36497 |
| Tag: | GST |
| Amino Acid Sequence: | MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKR VQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSP EHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNI PVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE |
| Sequence Similarities: | Belongs to the SAP30 family. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 183 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0034 | SALL1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0058 | 3-Deazaadenosine | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0152 | Recombinant Human SAP30L 293 Cell Lysate | Inquiry |
| EL-0155 | Recombinant Human SAP30BP 293 Cell Lysate | Inquiry |
| EL-0164 | Recombinant Human SAP30 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| SAH | SALL1 | SALL4 | SAP130 |
| SAP145 | SAP18 | SAP30 | SAP30BP |
| SAP30L | SART3 | SATB1 | SATB2 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
