| Cat.No.: | PE-2261 |
| Background: | SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. SPT3 regulates Ty1 as well as the mating factor genes. It interacts directly with TATA-binding protein, and is likely to be required for normal TBP function at a subset of RNA polymerase II-dependent promoters. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Positive regulator of Ty transcription/SPT3/SPT3 like protein |
| Tag: | GST |
| Amino Acid Sequence: | MVVFGTTFFNFDSFIGKTDSIEIIGKSVFPYCYHNILPLLNDSGRYSLGD ARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRK DKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQD FLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESR QLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLV RQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREA IRRYSHRIGPLSPFTNAYRRNGMAFLAC |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 328 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0089 | Recombinant Human SP2 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0161 | Human SP1 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0169 | Human SP140L Knockout Cell Line | Inquiry |
| CL-0170 | Human SP100 Knockout Cell Line 20bp deletion | Inquiry |
| CL-0171 | Human SP110 Knockout Cell Line 7bp deletion | Inquiry |
| Related Gene / Proteins | |||
| SP1 | SP100 | SP110 | SP140 |
| SP140L | SP2 | SP3 | SP6 |
| SPDL1 | SPF30 | SPIN1 | SPOP |
| SPT16 | SPT3 | Spt6 | SPTY2D1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.