Cat.No.: | PE-2260 |
Product Name: | Recombinant Human SRC3 protein |
Background: | Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Displays histone acetyltransferase activity. Also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit. Interacts with PSMB9. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | ACTR/AIB 1/AIB-1 |
Tag: | GST |
Amino Acid Sequence: | RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK LFRNPVTNDR |
Sequence Similarities: | Belongs to the SRC/p160 nuclear receptor coactivator family.Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAS (PER-ARNT-SIM) domain. |
Expression System: | Wheat germ |
Post Translational Modifications: | Acetylated by CREBBP. Acetylation occurs in the RID domain, and disrupts the interaction with nuclear receptors and regulates its function.Methylated by CARM1.Phosphorylated by IKK complex. Regulated its function. |
Protein Length: | Protein fragment; 251 to 360 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Research Kits | ||
EKIT-0046 | HDAC3/NCOR1 fluorometric drug discovery Kit | Inquiry |
◆ Proteins & Enzymes | ||
PE-0046 | Recombinant Human NCOR1, GST-tagged | Inquiry |
◆ Antibodies | ||
EAb-0065 | NCOA1 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0143 | Recombinant Human NCOA1 293 Cell Lysate | Inquiry |
EL-0144 | Recombinant Human NCOA2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
NCAPD3 | NCAPH2 | NCOA1 | NCOA2 |
NCOA3 | NCoA4 | NCOR1 | ncor2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools