Recombinant Human SRC3 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2260
Background:  Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Displays histone acetyltransferase activity. Also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit. Interacts with PSMB9.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  ACTR/AIB 1/AIB-1
Tag:  GST
Amino Acid Sequence:  RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK LFRNPVTNDR
Sequence Similarities:  Belongs to the SRC/p160 nuclear receptor coactivator family.Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAS (PER-ARNT-SIM) domain.
Expression System:  Wheat germ
Post Translational Modifications:  Acetylated by CREBBP. Acetylation occurs in the RID domain, and disrupts the interaction with nuclear receptors and regulates its function.Methylated by CARM1.Phosphorylated by IKK complex. Regulated its function.
Protein Length:  Protein fragment; 251 to 360
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Research Kits
EKIT-0046 HDAC3/NCOR1 fluorometric drug discovery Kit Inquiry
◆ Proteins & Enzymes
PE-0046 Recombinant Human NCOR1, GST-tagged Inquiry
◆ Antibodies
EAb-0065 NCOA1 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0143 Recombinant Human NCOA1 293 Cell Lysate Inquiry
EL-0144 Recombinant Human NCOA2 293 Cell Lysate Inquiry
Related Gene / Proteins
NCAPD3 NCAPH2 NCOA1 NCOA2
NCOA3 NCoA4 NCOR1 ncor2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.