Recombinant Human UBE2Q2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2253
Product Name:  Recombinant Human UBE2Q2 protein
Background:  Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  LOC92912/UB2Q2_HUMAN/UBE2Q2
Tag:  GST
Amino Acid Sequence:  MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLP PPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLK WLICELCSLY
Sequence Similarities:  Belongs to the ubiquitin-conjugating enzyme family.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 110
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.