Cat.No.: | PE-2250 |
Product Name: | Recombinant Human USP34 protein |
Background: | Ubiquitin hydrolase that can remove conjugated ubiquitin from AXIN1 and AXIN2, thereby acting as a regulator of Wnt signaling pathway. Acts as an activator of the Wnt signaling pathway downstream of the beta-catenin destruction complex by deubiquitinating and stabilizing AXIN1 and AXIN2, leading to promote nuclear accumulation of AXIN1 and AXIN2 and positively regulate beta-catenin (CTNBB1)-mediated transcription. Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | Deubiquitinating enzyme 34/FLJ43910/KIAA0570 |
Tag: | GST |
Amino Acid Sequence: | CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDP EVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS |
Sequence Similarities: | Belongs to the peptidase C19 family. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
Protein Length: | Protein fragment; 3296 to 3395 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0006 | USP3 Polyclonal Antibody | Inquiry |
EAb-0007 | USP25 Polyclonal Antibody | Inquiry |
EAb-0008 | USP2 Polyclonal Antibody | Inquiry |
EAb-0009 | USP1 Polyclonal Antibody | Inquiry |
EAb-0010 | USP7 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
USF1 | USP1 | USP10 | USP11 |
USP12 | USP13 | USP14 | USP15 |
USP16 | USP17L11 | USP17L12 | USP17L13 |
USP17L15 | USP17L17 | USP17L1P | USP17L2 |
USP17L22 | USP17L28 | USP17L3 | USP17L5 More > |
USP17L8 | USP18 | USP19 | USP2 |
USP20 | USP21 | USP22 | USP24 |
USP25 | USP26 | USP27X | USP28 |
USP29 | USP3 | USP30 | USP31 |
USP32 | USP33 | USP34 | USP35 |
USP36 | USP37 | USP38 | USP40 |
USP42 | USP43 | USP44 | USP45 |
USP46 | USP47 | USP48 | USP49 |
USP5 | USP53 | USP54 | USP6 |
USP6NL | USP7 | USP8 | USP9X |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools