Cat.No.: | PE-2242 |
Product Name: | Recombinant Human RNF11 protein |
Background: | Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | CGI 123/RING finger protein 11/RNF11 |
Tag: | GST |
Amino Acid Sequence: | EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRF LPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN |
Sequence Similarities: | Contains 1 RING-type zinc finger. |
Expression System: | Wheat germ |
Post Translational Modifications: | Ubiquitinated in the presence of SMURF2 and UBE2D1, as well as WWP1.Phosphorylation by PKB/AKT1 may accelerate degradation by the proteasome. |
Protein Length: | Protein fragment; 65 to 154 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0123 | Human RNF167 Knockout Cell Line | Inquiry |
CL-0124 | Human RNF2 Knockout Cell Line 553bp insertion | Inquiry |
CL-0125 | Human RNF25 Knockout Cell Line | Inquiry |
CL-0126 | Human RNF26 Knockout Cell Line | Inquiry |
CL-0127 | Human RNF24 Knockout Cell Line | Inquiry |
Related Gene / Proteins | |||
RNA Helicase A | RNA pol II | RNF103 | RNF11 |
RNF128 | RNF133 | RNF138 | RNF141 |
RNF167 | RNF168 | RNF181 | RNF182 |
RNF183 | RNF2 | RNF20 | RNF207 |
RNF208 | RNF212 | RNF213 | RNF214 More > |
RNF215 | RNF217 | RNF219 | RNF220 |
RNF222 | RNF223 | RNF224 | RNF24 |
RNF25 | RNF26 | RNF31 | RNF40 |
RNF7 | RNF8 | RNP | RNPC3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools