Recombinant Human RbAp48 protein (Tagged-His Tag)


  • Specification
  • Related Products
Cat.No.:  PE-2228
Product Name:  Recombinant Human RbAp48 protein (Tagged-His Tag)
Background:  Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
Applications:  Functional Studies; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  48 kDa including tags
Purity:  >46 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.0; Preservative: 1.36% Imidazole; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol
Accession#:  Q09028
Alternative Names:  CAF I p48/CAF-1 subunit C/CAF-I 48 kDa subunit
Tag:  His
Amino Acid Sequence:  ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLP DVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSE KGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLV FDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT ICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE SLFGSVADD QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVA LWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSK IGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIM QVWQMAENIYNDEDPEGSVDPEGQGS
Sequence Similarities:  Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.Contains 6 WD repeats.
Expression System:  Sf9 Insect Cells
Protein Length:  Full length protein; 2 to 425
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.