Recombinant Human CDA protein


  • Specification
  • Related Products
Cat.No.:  PE-2219
Background:  CDA (Cytidine deaminase) scavengers exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Growth inhibition of granulocyte-macrophage colony foring cells by human cytidine deaminase requires the catalytic function of the protein. It is highly expressed in granulocytes.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  18 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0584% EDTA, 40% Glycerol, 0.58% Sodium chloride
Accession#:  P32320
Alternative Names:  CDD/Cytidine aminohydrolase/Cytidine deaminase
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 146
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart