| Cat.No.: | PE-2190 |
| Product Name: | Recombinant Human WDR5 protein |
| Background: | Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 39 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride |
| Accession#: | P61964 |
| Alternative Names: | 2410008O07Rik/AA408785/AA960360 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPSSSATQSKPTP VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSN YVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL AATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW KSDC |
| Sequence Similarities: | Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 334 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0005 | WDR5 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0052 | Recombinant Human WDTC1 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0187 | OICR-9429 | Inquiry |
| BSM-0256 | WDR5 0103 | Inquiry |
| BSM-0335 | MM-102 | Inquiry |
| Related Gene / Proteins | |||
| WDHD1 | WDR4 | WDR5 | WDR77 |
| WDR82 | WDTC1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
