Cat.No.: | PE-2190 |
Product Name: | Recombinant Human WDR5 protein |
Background: | Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. |
Applications: | Mass Spectrometry; SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 39 kDa including tags |
Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography techniques. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride |
Accession#: | P61964 |
Alternative Names: | 2410008O07Rik/AA408785/AA960360 |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPSSSATQSKPTP VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSN YVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL AATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW KSDC |
Sequence Similarities: | Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats. |
Expression System: | E. coli |
Protein Length: | Full length protein; 1 to 334 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0005 | WDR5 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0052 | Recombinant Human WDTC1 293 Cell Lysate | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0187 | OICR-9429 | Inquiry |
BSM-0256 | WDR5 0103 | Inquiry |
BSM-0335 | MM-102 | Inquiry |
Related Gene / Proteins | |||
WDHD1 | WDR4 | WDR5 | WDR77 |
WDR82 | WDTC1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools