| Cat.No.: | PE-2183 |
| Background: | Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 15 kDa including tags |
| Purity: | >69 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol |
| Accession#: | NM_001003694 |
| Alternative Names: | BR140/Bromodomain and PHD finger containing 1/Bromodomain and PHD finger-containing protein 1 |
| Tag: | His |
| Amino Acid Sequence: | MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPD YLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIF YRAAVRLREQGGAVLRQARRQAEKMG |
| Sequence Similarities: | Contains 1 bromo domain.Contains 1 C2H2-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
| Expression System: | E. coli |
| Post Translational Modifications: | Acetylated by KAT6A. |
| Protein Length: | Protein fragment; 628 to 746 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
| SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
| SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
| SP-0004 | Bromodomain Ligand 3 | Inquiry |
| SP-0006 | Bromodomain Ligand 4 | Inquiry |
| Related Gene / Proteins | |||
| BRCA1 | BRCA2 | BRCC3 | BRD |
| brd1 | brd2 | brd3 | brd4 |
| BRD7 | BRD8 | brd9 | brdt |
| BRL | BRM | BRMS1 | BRPF1 |
| BRPF2 | brpf3 | BRWD1 | BRWD3 More > |
| PELP1 | Pentraxin | Peregrin | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.