Recombinant Human Peregrin/BRPF1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2183
Product Name:  Recombinant Human Peregrin/BRPF1 protein
Background:  Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  15 kDa including tags
Purity:  >69 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol
Accession#:  NM_001003694
Alternative Names:  BR140/Bromodomain and PHD finger containing 1/Bromodomain and PHD finger-containing protein 1
Tag:  His
Amino Acid Sequence:  MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPD YLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIF YRAAVRLREQGGAVLRQARRQAEKMG
Sequence Similarities:  Contains 1 bromo domain.Contains 1 C2H2-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Expression System:  E. coli
Post Translational Modifications:  Acetylated by KAT6A.
Protein Length:  Protein fragment; 628 to 746
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.