Cat.No.: | PE-2181 |
Product Name: | Recombinant Human TAF1 protein |
Background: | TAF1 functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. Compared to higher eukaryotes TAF1, yeast TAF1 lacks the C-terminal bromodomains and C-terminal kinase activity. The TFIID interacting proteins BDF1 and BDF2 may substitute for these domains. |
Applications: | SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 15 kDa including tags |
Purity: | >95 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 8; Constituents: 0.64% Tris HCl, 0.63% Sodium chloride, 20% Glycerol, 0.02% Potassium chloride |
Accession#: | P21675-2 |
Alternative Names: | BA2R/CCG 1/CCG1 |
Tag: | His |
Amino Acid Sequence: | MHHHHHHTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKII TRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQ SMLDLCDEKLKEKEDKLARLEKAINP |
Expression System: | E. coli |
Protein Length: | Protein fragment; 1400 to 1518 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0017 | TAF1 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0056 | Recombinant Human TAL1 293 Cell Lysate | Inquiry |
EL-0108 | Recombinant Human TAF7 293 Cell Lysate | Inquiry |
EL-0178 | Recombinant Human TADA1 Lysate | Inquiry |
◆ Cell Lines | ||
CL-0121 | Human TAP2 Knockout Cell Line | Inquiry |
Related Gene / Proteins | |||
TADA1 | TADA1L | TADA2A | TADA2B |
TADA3 | TAE1 | TAF-I | taf1 |
TAF1L | TAF6L | TAF7 | TAF7L |
TAL1 | TAP2 | TAZ |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools