Recombinant Human TRIM13 protein


  • Specification
  • Related Products
Cat.No.:  PE-2163
Product Name:  Recombinant Human TRIM13 protein
Background:  E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor.
Applications:  Western blot; ELISA; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  74 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  O60858-3
Alternative Names:  B cell chronic lymphocytic leukemia tumor suppressor Leu5/B-cell chronic lymphocytic leukemia tumor suppressor Leu5/CAR
Amino Acid Sequence:  MDVMELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLW RPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGH LGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQ SFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKK NEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIV FLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKL SLPQDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATW KGCLSNFSSYLTKTADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNV AEFVCKYKLL
Sequence Similarities:  Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Post Translational Modifications:  Auto-ubiquitinated; requires the RING-type zinc finger. Auto-polyubiquitination leads to proteasomal degradation.
Protein Length:  Full length protein; 1 to 410
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.