Recombinant Human TRIM37/MUL protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2162
Background:  E3 ubiquitin-protein ligase.
Applications:  ELISA; Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  37 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.3% Glutathione, 0.79% Tris HCl
Accession#:  O94972
Alternative Names:  E3 ubiquitin protein ligase TRIM37/E3 ubiquitin-protein ligase TRIM37/KIAA0898
Amino Acid Sequence:  GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEE QEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
Sequence Similarities:  Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 MATH domain.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Post Translational Modifications:  Auto-ubiquitinated.
Protein Length:  Protein fragment; 865 to 964
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.