| Cat.No.: | PE-2159 |
| Product Name: | Recombinant Human WDR77 protein (Tagged) |
| Background: | Non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. Might play a role in transcription regulation. The 20S PRMT5-containing methyltransferase complex also methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 50 kDa including tags |
| Purity: | > 90 % SDS-PAGE. |
| Species: | Human |
| Formulation: | Constituents: 50% Glycerol, Tris buffer |
| Accession#: | Q9BQA1-1 |
| Alternative Names: | 2610312E17Rik/Androgen receptor cofactor p44/C79984 |
| Tag: | His |
| Amino Acid Sequence: | MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS GRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDS GAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIK VWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCP KPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLS SAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV RDATWSPLNHSL |
| Sequence Similarities: | Contains 5 WD repeats. |
| Expression System: | E. coli |
| Protein Length: | Protein fragment; 1 to 312 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0005 | WDR5 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0052 | Recombinant Human WDTC1 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0187 | OICR-9429 | Inquiry |
| BSM-0256 | WDR5 0103 | Inquiry |
| BSM-0335 | MM-102 | Inquiry |
| Related Gene / Proteins | |||
| WDHD1 | WDR4 | WDR5 | WDR77 |
| WDR82 | WDTC1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools