| Cat.No.: | PE-2158 |
| Product Name: | Recombinant Human Rad6 protein |
| Background: | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11', as well as 'Lys-48'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. |
| Applications: | SDS-PAGE; Immunohistochemistry methylmethacrylate sections |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 19 kDa |
| Purity: | > 95 % SDS-PAGE. Purified by standard chromatography. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.03% EDTA |
| Accession#: | P49459 |
| Alternative Names: | BHR6A/hHR6A/HR6A |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSTPARRRLMRDFKRLQEDPPAGVSGAPSE NNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPN VYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY QENKREYEKRVSAIVEQSWRDC |
| Sequence Similarities: | Belongs to the ubiquitin-conjugating enzyme family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 152 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0044 | RARA Polyclonal Antibody | Inquiry |
| EAb-0356 | RAD54L2 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0316 | TZ9 | Inquiry |
| ◆ Cell Lines | ||
| CL-0390 | Human RAD52 Knockout Cell Line 2bp insertion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1231 | Recombinant Human RAC3, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| RAC3 | Rad21 | RAD52 | RAD54L2 |
| Rad6 | Rad6B | RAG1 | RAG2 |
| RALY | RALYL | RANBP2 | RAP1 |
| RAR-β | RAR-γ | RARA | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools