Recombinant Human CDYL protein


  • Specification
  • Related Products
Cat.No.:  PE-2150
Product Name:  Recombinant Human CDYL protein
Background:  Acts as repressor of transcription (By similarity). Has histone acetyltransferase activity, with a preference for histone H4.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  CDY-like/CDY-like autosomal/Cdyl
Tag:  GST
Amino Acid Sequence:  LVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSP VKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERA RMGSRPRI
Sequence Similarities:  Contains 1 chromo domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 153 to 260
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.