| Cat.No.: | PE-2148 |
| Product Name: | Recombinant Human CLLD8/SETDB2 protein |
| Background: | Histone methyltransferase involved in left-right axis specification in early development and mitosis. Specifically trimethylates 'Lys-9' of histone H3 (H3K9me3). H3K9me3 is a specific tag for epigenetic transcriptional repression that recruits HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Contributes to H3K9me3 in both the interspersed repetitive elements and centromere-associated repeats. Plays a role in chromosome condensation and segregation during mitosis. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q96T68 |
| Alternative Names: | C13orf4/Chromosome 13 open reading frame 4/Chronic lymphocytic leukemia deletion region 8 |
| Tag: | GST |
| Amino Acid Sequence: | HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQ HNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family.Contains 1 MBD (methyl-CpG-binding) domain.Contains 1 pre-SET domain.Contains 1 SET domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 451 to 550 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 More > |
| SETMAR | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools