Recombinant Human CLLD8/SETDB2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2148
Product Name:  Recombinant Human CLLD8/SETDB2 protein
Background:  Histone methyltransferase involved in left-right axis specification in early development and mitosis. Specifically trimethylates 'Lys-9' of histone H3 (H3K9me3). H3K9me3 is a specific tag for epigenetic transcriptional repression that recruits HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Contributes to H3K9me3 in both the interspersed repetitive elements and centromere-associated repeats. Plays a role in chromosome condensation and segregation during mitosis.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q96T68
Alternative Names:  C13orf4/Chromosome 13 open reading frame 4/Chronic lymphocytic leukemia deletion region 8
Tag:  GST
Amino Acid Sequence:  HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQ HNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED
Sequence Similarities:  Belongs to the histone-lysine methyltransferase family.Contains 1 MBD (methyl-CpG-binding) domain.Contains 1 pre-SET domain.Contains 1 SET domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 451 to 550
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.