Recombinant human EHMT2/G9A protein


  • Specification
  • Related Products
Cat.No.:  PE-2145
Product Name:  Recombinant human EHMT2/G9A protein
Background:  Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself.
Applications:  SDS-PAGE; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  75 kDa including tags
Purity:  >50 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8; Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.05% DTT, 0.02% Potassium chloride, 10% Glycerol
Accession#:  Q96KQ7
Alternative Names:  Ankyrin repeat containing protein/Bat 8/Bat8
Tag:  GST
Amino Acid Sequence:  GWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIA EVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEG DTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVP IPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSN CLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQS GIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDS YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFP RIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIAL EQSRLARLDPHPELLPELGS LPPVNT
Sequence Similarities:  Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar3-9 subfamily.Contains 7 ANK repeats.Contains 1 post-SET domain.Contains 1 pre-SET domain.Contains 1 SET domain.
Expression System:  Sf9 Insect Cells
Post Translational Modifications:  Methylated at Lys-185; automethylated.
Protein Length:  Protein fragment; 785 to 1210
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Bioactive Small Molecules
BSM-0025 BIX01294 (hydrochloride hydrate) Inquiry
BSM-0026 UNC0224 Inquiry
BSM-0027 UNC0321 (trifluoroacetate salt) Inquiry
◆ Cell Lines
CL-0059 Human EHMT1 Knockout Cell Line 7bp deletion Inquiry
CL-0060 Human EHMT2 Knockout Cell Line 34bp deletion Inquiry
Related Gene / Proteins
EHD2 EHMT1 EHMT2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.