| Cat.No.: | PE-2145 |
| Product Name: | Recombinant human EHMT2/G9A protein |
| Background: | Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself. |
| Applications: | SDS-PAGE; Functional Studies |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 75 kDa including tags |
| Purity: | >50 % SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8; Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.05% DTT, 0.02% Potassium chloride, 10% Glycerol |
| Accession#: | Q96KQ7 |
| Alternative Names: | Ankyrin repeat containing protein/Bat 8/Bat8 |
| Tag: | GST |
| Amino Acid Sequence: | GWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIA EVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEG DTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVP IPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSN CLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQS GIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDS YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFP RIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIAL EQSRLARLDPHPELLPELGS LPPVNT |
| Sequence Similarities: | Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar3-9 subfamily.Contains 7 ANK repeats.Contains 1 post-SET domain.Contains 1 pre-SET domain.Contains 1 SET domain. |
| Expression System: | Sf9 Insect Cells |
| Post Translational Modifications: | Methylated at Lys-185; automethylated. |
| Protein Length: | Protein fragment; 785 to 1210 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0025 | BIX01294 (hydrochloride hydrate) | Inquiry |
| BSM-0026 | UNC0224 | Inquiry |
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Cell Lines | ||
| CL-0059 | Human EHMT1 Knockout Cell Line 7bp deletion | Inquiry |
| CL-0060 | Human EHMT2 Knockout Cell Line 34bp deletion | Inquiry |
| Related Gene / Proteins | |||
| EHD2 | EHMT1 | EHMT2 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
