Recombinant Human JMJD1C protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2138
Background:  Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  JHD2C_HUMAN/Jmjd1c/Jumonji domain containing 1C
Tag:  GST
Amino Acid Sequence:  IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNV NAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD
Sequence Similarities:  Belongs to the JHDM2 histone demethylase family.Contains 1 JmjC domain.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated upon DNA damage, probably by ATM or ATR.
Protein Length:  Protein fragment; 2 to 99
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.