Recombinant human UBE2E3 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2124
Background:  Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
Applications:  SDS-PAGE; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  22 kDa
Purity:  > 95 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8; Constituents: 1.19% HEPES, 10% Glycerol, 0.29% Sodium chloride, 0.02% DTT
Accession#:  Q969T4
Alternative Names:  Homologous to yeast UBC4/5/UB2E3_HUMAN/UBC E4
Tag:  His
Amino Acid Sequence:  MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT
Sequence Similarities:  Belongs to the ubiquitin-conjugating enzyme family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 207
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.