Recombinant Human UBE2M/UBC12 protein


  • Specification
  • Related Products
Cat.No.:  PE-2123
Background:  Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  21 kDa
Purity:  > 95 % SDS-PAGE.
Species:  Human
Formulation:  Constituents: 0.24% Tris, 0.87% Sodium chloride, 10% Glycerol, 0.02% Beta mercaptoethanol
Accession#:  P61081
Alternative Names:  hUbc12/NEDD8 carrier protein/NEDD8 conjugating enzyme Ubc12
Amino Acid Sequence:  MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDIS FSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVY HPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAA EVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Sequence Similarities:  Belongs to the ubiquitin-conjugating enzyme family. UBC12 subfamily.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 183
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart