| Cat.No.: | PE-2123 |
| Product Name: | Recombinant Human UBE2M/UBC12 protein |
| Background: | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 21 kDa |
| Purity: | > 95 % SDS-PAGE. |
| Species: | Human |
| Formulation: | Constituents: 0.24% Tris, 0.87% Sodium chloride, 10% Glycerol, 0.02% Beta mercaptoethanol |
| Accession#: | P61081 |
| Alternative Names: | hUbc12/NEDD8 carrier protein/NEDD8 conjugating enzyme Ubc12 |
| Amino Acid Sequence: | MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDIS FSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVY HPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAA EVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Sequence Similarities: | Belongs to the ubiquitin-conjugating enzyme family. UBC12 subfamily. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 183 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0026 | Human UBAP1 Knockout Cell Line | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0162 | Synthetic Human Ubiquitin protein (Biotin) | Inquiry |
| SP-0163 | Human Ubiquitin peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0174 | UBE2G1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0315 | NSC 697923 | Inquiry |
| Related Gene / Proteins | |||
| UB2D1 | UB2D2 | UB2D3 | UB2R1 |
| UBA1 | UBA5 | UBA7 | UBAP1 |
| UBB | UBC | UBC12 | Ubc13 |
| Ubc3B | UbcH1 | UbcH2 | UbcH3 |
| UbcH5a | UbcH5b | UbcH5c | UbcH8 More > |
| UBD | UBE1L | UBE2B | UBE2C |
| UBE2D1 | UBE2D3 | UBE2DNL | UBE2E1 |
| UBE2E2 | UBE2E3 | UBE2G1 | UBE2G2 |
| UBE2H | UBE2I | UBE2K | UBE2L3 |
| UBE2L6 | UBE2M | UBE2N | UBE2O |
| UBE2Q2 | UBE2R1 | UBE2R2 | UBE2T |
| UBE2V1 | UBE2V2 | UBE2W | UBE3A |
| Ube4a | Ubiquitin | UBL7 | Ubn1 |
| UBP5 | UBR2 | UBTD1 | UBTD2 |
| UBXN10 | UBXN2B | UBXN6 | UBXN8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools